|
| Catalog Number | Size | Price (USD) | Shopping Cart |
|---|---|---|---|
| RA21004 | 50 ul | $155.00 | Buy Now | Add to Cart |
Type: Rabbit IgG
Applications: IHC
ICC=Immunocytochemistry; IF=Immunofluorescence; IHC=Immunohistochemistry; WB=Western blotting; FC=Flow Cytometry; IP=Immunoprecipitation; E=ELISA; NB=Neutralization of Bioactivity; FACS; FM=Fluorescent Micsroscopy; ; FPLC=Fast Protein Liquid Chromatography; GF=Gravity Flow; HPLC=High Performance Liquid Chromatography; TPE=Targeted Protein Expression; ; ; AC=Adherent Cell Assays; ; ; NAC=Non-adherent Cell Assays; ; ; BSC-CM5= Biacore Sensor Chip CM5; ;
Species Reactivity: R
B=Bovine; Ca=Cat; Ch=Chicken; D=Dog; EQ=Equine; GP=Guinea Pig; H=Human; M=Mouse; P=Porcine; Pr=Primate; R=Rat; Rb=Rabbit; Y=Yeast; Xe=Xenopus; Ze=Zebrafish; ; ; ; NA-Not Applicable; STP=Step-Tactin Proteins
Immunogen: YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
Description/Data:

β-lipotropin is a 90 amino acid polypeptide that is the carboxy-terminal fragment of POMC. It stimulates melanocytes to produce melanin, and can also be cleaved into smaller peptides. In humans, γ-lipotropin, α-MSH, β-MSH, γ-MSH, α-endorphin, β-endorphin, γ-endorphin, and met-enkephalin are all possible fragments of β-lipotropin. β-lipotropin also performs lipid-mobilizing functions such as lipolysis and steroidogenesis.
Image: Detection of beta-Endorphin (dark-blue varicosities and processes) in rat pituitary (HRP-DAB-with Ni enhancement).
More Links
| Primary Neurons and Astrocytes-Primary human, rat and mouse neurons and astrocytes |














