Catalog NumberSizePrice (USD)Shopping Cart
1198-11 mg$195.00Buy Now | Add to Cart
 
Type: Inhibitor
 
Applications: BSM
E=ELISA; FACS; FC=Flow Cytometry; FPLC=Fast Protein Liquid Chromatography; GF=Gravity Flow; HPLC=High Performance Liquid Chromatography; ICC=Immunocytochemistry; IF=Immunofluorescence; IHC=Immunohistochemistry; IP=Immunoprecipitation; NAC=Non-adherent Cell Assays; NB=Neutralization of Bioactivity; SE=Sandwich ELISA; TPE=Targeted Protein Expression; WB=Western blotting; ; AC=Adherent Cell Assays; FM=Fluorescent Micsroscopy; ; ; BSC-CM5= Biacore Sensor Chip CM5; BSM=Biosactive Small Molecule or Peptide; CDM=Cell Differentiation Media; ; ; ; ; ; Health and Fitness; ; ; DNA Extraction/Purification; ; In vivo Like Assays
Species Reactivity: H; R
B=Bovine; Ca=Cat; Ch=Chicken; D=Dog; EQ=Equine; GP=Guinea Pig; H=Human; M=Mouse; P=Porcine; Pr=Primate; R=Rat; Rb=Rabbit; Y=Yeast; Xe=Xenopus; Ze=Zebrafish; ; ; ; NA-Not Applicable; STP=Step-Tactin Proteins; All
Immunogen: MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ
 
Description/Data:

Biological Activity

Human putative counterpart of nocistatin (bovine). Blocks nociceptin-induced allodynia and hyperalgesia.

Sequence: MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ

Safety Data Sheet

Nocistatin or NST Data

 

 

 

 

 

 

 

 

 

 

 

 

 

 

Effects of NST on inhibitory synaptic transmission in rat dorsal horn neurons. A, Averages of 10 consecutively recorded IPSCs under control condition (control), in the presence of rNST1–17 (rNST; 10 μM), and after removal of rNST1–17 (wash).B, Concentration–response curves of rNST1–17 (solid line) and rNST1–35 and bNST (both dashed lines). Ordinate, Effect of NST on IPSC amplitudes expressed as relative remaining amplitude. Abscissa, NST concentration on a logarithmic scale. Data points were fitted to the following equation: y =y max − [(y max −y min)/(1 + (IC50/C)nH)].y max is the normalized IPSC amplitude under control conditions, y min is the relative IPSC amplitude in the presence of saturating concentrations of NST,C is the NST concentration, IC50 is the half-maximum effective concentration, and n His the Hill coefficient. rNST1–17 (●): average maximum inhibition, 45.7 ± 3.3%; IC50, 486 ± 129 nM; n H, 1.44 ± 0.59. rNST1–35 (▪): IC50, 863 ± 242 nM. bNST (■): IC50, 979 ± 347 nM. Inhibition was statistically significant (p = 0.05) for all concentrations of rNST1–17 (≥500 nM) (ANOVA followed by a Bonferronipost hoc test). n, Number of cells was 5–20 for each peptide and each concentration. The Journal of Neuroscience, 1 July 2000, 20(13): 4922-4929.