Product Details
Catalog Number: 1198-1
Applications: BSM
Type: Inhibitor
Immunogen: MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ
Format B: lyophilized
Species Reactivity: Human, Rat
Product Sizes
SizeList PricePriceCart
1 mg$195.00Add to Cart

Effects of NST on inhibitory synaptic transmission in rat dorsal horn neurons. A, Averages of 10 consecutively recorded IPSCs under control condition (control), in the presence of rNST1–17 (rNST; 10 μM), and after removal of rNST1–17 (wash).B, Concentration–response curves of rNST1–17 (solid line) and rNST1–35 and bNST (both dashed lines). Ordinate, Effect of NST on IPSC amplitudes expressed as relative remaining amplitude. Abscissa, NST concentration on a logarithmic scale. Data points were fitted to the following equation: y =y max − [(y max −y min)/(1 + (IC50/C)nH)].y max is the normalized IPSC amplitude under control conditions, y min is the relative IPSC amplitude in the presence of saturating concentrations of NST,C is the NST concentration, IC50 is the half-maximum effective concentration, and n His the Hill coefficient. rNST1–17 (●): average maximum inhibition, 45.7 ± 3.3%; IC50, 486 ± 129 nM; n H, 1.44 ± 0.59. rNST1–35 (▪): IC50, 863 ± 242 nM. bNST (■): IC50, 979 ± 347 nM. Inhibition was statistically significant (p = 0.05) for all concentrations of rNST1–17 (≥500 nM) (ANOVA followed by a Bonferronipost hoc test). n, Number of cells was 5–20 for each peptide and each concentration. The Journal of Neuroscience, 1 July 2000, 20(13): 4922-4929.

Images