Product Details
Catalog Number: 1198-1
Applications: BSM
Type: Inhibitor
Immunogen: MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ
Storage: Store at room temperature.
Shipping: Ambient
Format B: lyophilized
Species Reactivity: Human, Rat
Product Sizes
SizeList PricePriceCart
1 mg$195.00Add to Cart

Biological Activity

Human putative counterpart of nocistatin (bovine). Blocks nociceptin-induced allodynia and hyperalgesia.

Sequence: MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ

Safety Data Sheet

Images

Effects of NST on inhibitory synaptic transmission in rat dorsal horn neurons. The Journal of Neuroscience, 1 July 2000, 20(13): 4922-4929.

Effects of NST on inhibitory synaptic transmission in rat dorsal horn neurons. The Journal of Neuroscience, 1 July 2000, 20(13): 4922-4929.