Product Details
Catalog Number: 1198-1
Applications: BSM
Type: Inhibitor
Immunogen: MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ
Storage: Store at room temperature.
Shipping: Ambient
Format B: lyophilized
Species Reactivity: Human, Rat
Product Sizes
Size | List Price | Price | Cart |
---|---|---|---|
1 mg | $195.00 | Add to Cart |
Biological ActivityHuman putative counterpart of nocistatin (bovine). Blocks nociceptin-induced allodynia and hyperalgesia. Sequence: MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ |
- Product Reviews
Leave a review for this product and you could be eligible for a $10 Starbucks gift card.
- Product Publications
Product Publications
If you've used this product in a publication, let us know. Email rose@neuromics.com, with the publication details and you could be eligible for an Amazon gift card.
- Related Products
Related Products
Images
Effects of NST on inhibitory synaptic transmission in rat dorsal horn neurons. The Journal of Neuroscience, 1 July 2000, 20(13): 4922-4929.
Effects of NST on inhibitory synaptic transmission in rat dorsal horn neurons. The Journal of Neuroscience, 1 July 2000, 20(13): 4922-4929.