Product Details
Catalog Number: MO50016
Applications: ICC, WB, IHC, IP
Type: Mouse IgG
Immunogen: Fusion protein amino acids 428-499 (QYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, cytoplasmic C-terminus) of human Kv1.2 (also known as Potassium voltage-gated channel subfamily A member 2, Voltage-gated K(+) channel HuKIV or HBK5, Kcna2, NGK1, RAK, RBK2, RCK5 and MK2, accession number P16389), epitope mapped to within underlined sequence (amino acids 463-480).
Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Shipping: Frozen (Polar Packs)
Format A: Affinity Purified
Format B: liquid
Species Reactivity: Human, Mouse, Rat, Zebrafish, Xenopus
Entrez: 3737
UniProt: P16389
Downloads: Datasheet (pdf)
Product Sizes
SizeList PricePriceCart
100 ul$349.00Add to Cart

Kv1.2 K+ channels mediate the voltage-dependent potassium ion permeability of excitable membranes and are uniformly distributed in the heart and brain. Kv1.2 play diverse functional roles in several neuronal compartments, especially in the regulation of pre- and post-synaptic membrane excitability. Kv1.2 subunits can co-localize with other Kv1 subunits. For example, Kv1.2 colocalizes with Kv1.1 in the nodes of Ranvier in myelinated axons, and in the brain.

Changes in K+ channel function have been associated with cardiac hypertrophy and failure, apoptosis and oncogenesis, and various neurodegenerative and neuromuscular disorders.

Note: Antibody has been developed by UC Davis under a grant by NIH.

Images
Kv1.2 staining of adult rat hippocampus.

Kv1.2 staining of adult rat hippocampus.

Kv1.2 staining of adult rat hippocampus.

Kv1.2 staining of adult rat hippocampus.

Kv1.2 western blots of membranes from whole rat (RBM) and mouse (MBM) brain and from human cerebral cortex [HBM(Cx)] and hippocampus [HBM(H)].

Kv1.2 western blots of membranes from whole rat (RBM) and mouse (MBM) brain and from human cerebral cortex [HBM(Cx)] and hippocampus [HBM(H)].

Kv1.2 western blots of membranes from whole rat (RBM) and mouse (MBM) brain and from human cerebral cortex [HBM(Cx)] and hippocampus [HBM(H)].

Kv1.2 western blots of membranes from whole rat (RBM) and mouse (MBM) brain and from human cerebral cortex [HBM(Cx)] and hippocampus [HBM(H)].